PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400056403
Common NameLOC102587613
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NF-YB
Protein Properties Length: 199aa    MW: 21809.8 Da    PI: 4.4784
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400056403genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB136.57.5e-4327120295
                 NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                           +eqd f+Pi nv+ im+k+lP +akis+++k  +qecvsefi+fvt++a+d+cqre+rkti ++d+l al ++Gf+dy++pl++yl++y
  PGSC0003DMP400056403  27 QEQDPFMPIGNVVIIMRKILPPHAKISNESKVAIQECVSEFIGFVTGQANDNCQREQRKTIMAEDVLSALNDFGFDDYIKPLSLYLHRY 115
                           79*************************************************************************************** PP

                 NF-YB  91 releg 95 
                           re++g
  PGSC0003DMP400056403 116 REVNG 120
                           **987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.3E-3924122IPR009072Histone-fold
SuperFamilySSF471134.35E-3229121IPR009072Histone-fold
PfamPF008082.4E-203296IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.1E-106078No hitNo description
PRINTSPR006152.1E-107997No hitNo description
PRINTSPR006152.1E-1098116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
METGLALAIL LHPANAALLE LFECPIQEQD PFMPIGNVVI IMRKILPPHA KISNESKVAI  60
QECVSEFIGF VTGQANDNCQ REQRKTIMAE DVLSALNDFG FDDYIKPLSL YLHRYREVNG  120
GVGGSLKREP LLLNRPMVDP ASSCSIMPNH LPPNFDMNHP PPMGDGFMQE DASNGRTSQC  180
TVSTVDNEVD SLANEGKE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-3126117192Transcription factor HapC (Eurofung)
4g92_B4e-3126117192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-175HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006352177.11e-146PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotQ84W662e-48NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLM1D7W91e-146M1D7W9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000847241e-146(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.24e-50nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]